PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01047.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 334aa    MW: 36108.3 Da    PI: 8.848
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01047.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.91.8e-0768111542
                      zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                   +C+ +e+ ++ l C+ +   lC+ C  + H+       H++vp+
  Zmw_sc01047.1.g00060.1.am.mk  68 ICEACERLPAVLACRADAASLCAICDAQVHSAnplagrHQRVPV 111
                                   7*****************************66999999999986 PP

2CCT64.14.1e-22182225144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea++ RY+eK+k+RkF+K+irY++RK++Ae RpR+KGrF+k++
  Zmw_sc01047.1.g00060.1.am.mk 182 REARVHRYREKKKNRKFKKTIRYATRKTYAEARPRIKGRFAKRS 225
                                   9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.4E-42168IPR000315B-box-type zinc finger
CDDcd000215.39E-52468No hitNo description
PROSITE profilePS501198.7452668IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3164111IPR000315B-box-type zinc finger
PfamPF006431.3E-568111IPR000315B-box-type zinc finger
CDDcd000214.59E-768111No hitNo description
SMARTSM003362.6E-869111IPR000315B-box-type zinc finger
PROSITE profilePS5101716.311182224IPR010402CCT domain
PfamPF062039.1E-17182224IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MNYNSSGNVF EQEGGGGESC PWVRPCYGCH AAPSVVYCHA DVAYLCASCD TRVHAANRVA  60
SRHERVCICE ACERLPAVLA CRADAASLCA ICDAQVHSAN PLAGRHQRVP VLPLPAAAIP  120
AASVLAEVAA ASTALAEKEE EVDSWLLLVA MANKQQQNYY GGAEHAASVT AGMPLHFSSM  180
EREARVHRYR EKKKNRKFKK TIRYATRKTY AEARPRIKGR FAKRSDMEEE VDQMFSIAAL  240
SDGSYGPLAK ENALCGVCTS SARRHDSNGP QRRRVIAAPP PLALVNASLA ILRRGHWAGP  300
VPSCCSHLGR SGVDWGPAIT RGGPCRAQFT KLVL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436860.11e-65hypothetical protein SORBIDRAFT_10g010050
SwissprotQ9SK532e-55COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLD1MWS78e-99D1MWS7_ORYSA; Heading date1
STRINGSb10g010050.13e-65(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140